PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g061070.1
Common NameMTR_6g061070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 474aa    MW: 54380.3 Da    PI: 7.2832
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g061070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-15230321697
                      ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++ ++ + +rl++p  f +e++++   + + t+++  + r   v+l+++k+++++v++ GWk+F k+++Lk gD + F++++r+  +++++++
  Medtr6g061070.1 230 LSRYYVEGDRLRIPIWFSKENMNE-LLQGKATIRSvGEDRARYVTLNFDKSKSSFVMQVGWKSFTKEHDLKIGDACKFEMTQREPLSFTITII 321
                      3677888999**********9544.45557888885667999999999*******************************99999988888876 PP

2B331.72.6e-103904641491
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                      + l++  + +++h++ +  s++l+       +W v+++y+++ +  ++tkGW eFv++ ++k gD+++F+l++ ++  
  Medtr6g061070.1 390 DKLIVLPSLLKRHNIFSGDSVELK--V-GEGTWFVEVSYNQYLDYGWFTKGWPEFVRECNVKIGDTCLFELIDVQNHV 464
                      555555556666644434444444..3.4479**************************************99765543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.67E-1215107IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-1016106IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.01924107IPR003340B3 DNA binding domain
CDDcd100174.86E-732105No hitNo description
Gene3DG3DSA:2.40.330.103.5E-15220319IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-15221321IPR015300DNA-binding pseudobarrel domain
CDDcd100176.19E-14224322No hitNo description
SMARTSM010191.8E-8225324IPR003340B3 DNA binding domain
PROSITE profilePS5086310.757225324IPR003340B3 DNA binding domain
PfamPF023622.0E-13228322IPR003340B3 DNA binding domain
SMARTSM010196.6E-5381473IPR003340B3 DNA binding domain
CDDcd100175.73E-11382470No hitNo description
SuperFamilySSF1019364.9E-11382469IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.2E-13385470IPR015300DNA-binding pseudobarrel domain
PfamPF023626.6E-8386466IPR003340B3 DNA binding domain
PROSITE profilePS508638.98418473IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MVSIVHNGRG SEAKGMHFYL TIQFLQMHDQ DLMIPRNFVE RYWKDVSNPI SLKFPNKSQC  60
KMNWEQRGDD IWLLNWKRFA RSLRCGDLLV FQYKGGSDFH VIIFDVSKLE IDYSSIGCND  120
NEENNKESDD DYDVEIPSDS ENTKISINKK RINLNDIATT AATPQGTNIH KRKTNINATQ  180
QNVSGNFAEA NRNRGGREKK AKECTKTKDG NERSCTNSHP NENPSFTLKL SRYYVEGDRL  240
RIPIWFSKEN MNELLQGKAT IRSVGEDRAR YVTLNFDKSK SSFVMQVGWK SFTKEHDLKI  300
GDACKFEMTQ REPLSFTITI IPAPKEPSLE QFQENQRVQG KSVTTRVEDM EYVGNFGEGS  360
SKSCTKTHGL RNSVSPDSHE KFKVFVTSLD KLIVLPSLLK RHNIFSGDSV ELKVGEGTWF  420
VEVSYNQYLD YGWFTKGWPE FVRECNVKIG DTCLFELIDV QNHVFEVSII LDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452436.10.0B3 DNA-binding domain protein
TrEMBLA0A072U9K20.0A0A072U9K2_MEDTR; B3 DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11472624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-14B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]